PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_7_00316
Common NameCHLNCDRAFT_144374
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family CPP
Protein Properties Length: 703aa    MW: 70822.7 Da    PI: 6.7344
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_7_00316genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.21.8e-14153191342
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C N++e+
  IGS.gm_7_00316 153 KKHCNCKNSRCLKLYCECFASGRYCDG-CNCLNCYNNREH 191
                     79*************************.********9986 PP

2TCR53.54.6e-17227266140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     +++kgCnCkks ClkkYCeCf+ag  Cse CkC dCkN e
  IGS.gm_7_00316 227 RHNKGCNCKKSGCLKKYCECFQAGIVCSEICKCLDCKNYE 266
                     589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.0E-14151191IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.76152267IPR005172CRC domain
PfamPF036382.4E-10153188IPR005172CRC domain
SMARTSM011145.3E-20227268IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.8E-13230265IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MQQQQQQQQP QQGAAGAPNP SQGQQQAQAA VAAAASAQQM AAAASAQQAA ALAAMLPAAA  60
AGGARPALAL HPALAAIQGN QGLTMLPMAG PAGTFTFAAR PGMPQPFFYP AVPQPVAPLA  120
PSPSAAAAAA AAAARRPSSR PGSRSSSAAA AGKKHCNCKN SRCLKLYCEC FASGRYCDGC  180
NCLNCYNNRE HEATRQSAVE AILERNPNAF RPKIAPGADN RRAGGARHNK GCNCKKSGCL  240
KKYCECFQAG IVCSEICKCL DCKNYEGSEA RDALVSPQGE RQGSPVGLRR TSRTISPSGP  300
GARPGFASPG AAAPAAAAGS GSLPSLAQLQ QAQAAAAAQA VAAQAAAGQP ASLAAEQKQQ  360
VAREVVREVV KPELVEKLAM LLMLVSQEEH ERRQLPTPSP SHSAAAAATQ REAEGGAQAA  420
SPGSSPAGAA GGGAGEDEAA AMDVDMAQQA AAEAAGGAAG KEEPAEQAPA ADAALVKLES  480
MDVDTGAEAA VVGPATAEQR DAAAPAANGG AGEEEAEEMG LYAAQERLVL TEFRDTMQMI  540
SRLVGEKVEK KVQQAQQAQQ ALLPTSQQGT PSVVGMAPLP QLRPAAQASQ PGSAGMFMPG  600
QPQLVLLPPA LMAQQLAAAG QTANALGMAM TLQQTPQGFQ AVYKSMDPQQ AGAAAAPAAA  660
GAPAGTPVLQ PLQLPPLPQP QPQQAQQQEA AATPAVDDGG TQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005848925.10.0hypothetical protein CHLNCDRAFT_144374
TrEMBLE1ZBA80.0E1ZBA8_CHLVA; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP3231530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.16e-59Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]